Neuromedin S (human) trifluoroacetate salt,CAS: 1138204-27-9
H-Ile-Leu-Gln-Arg-Gly-Ser-Gly-Thr-Ala-Ala-Val-Asp-Phe-Thr-Lys-Lys-Asp-His-Thr-Ala-Thr-Trp-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH₂ trifluoroacetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-1005 | 0.5mg | 310.00 | + Add to cart |
|
R-M-1005 | 1mg | 500.00 | + Add to cart |
|
|
Product description
The 33-amino acid neuropeptide neuromedin S (NMS) was originally isolated from rat brain as an endogenous ligand for two orphan G protein-coupled receptors FM-3/GPR66 and FM-4/TGR-1, which have been identified as neuromedin U (NMU) receptors. hNMS-33 is specifically expressed in the suprachiasmatic nuclei (SCN) of the hypothalamus. It has been shown that NMS is implicated in the regulation of circadian rhythms through autocrine and/or paracrine actions.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 1138204-27-9 |
Sequence | ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH₂ |
Synonyms | NMS (human) |
Molecular Formula | C₁₇₃H₂₆₅N₅₃O₄₄ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product