X
Email:
sales@ruixibiotech.com

Neuromedin S (human) trifluoroacetate salt,CAS: 1138204-27-9

H-Ile-Leu-Gln-Arg-Gly-Ser-Gly-Thr-Ala-Ala-Val-Asp-Phe-Thr-Lys-Lys-Asp-His-Thr-Ala-Thr-Trp-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH₂ trifluoroacetate salt

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1005 0.5mg 310.00
- +
+ Add to cart
R-M-1005 1mg 500.00
- +
+ Add to cart

Product description

The 33-amino acid neuropeptide neuromedin S (NMS) was originally isolated from rat brain as an endogenous ligand for two orphan G protein-coupled receptors FM-3/GPR66 and FM-4/TGR-1, which have been identified as neuromedin U (NMU) receptors. hNMS-33 is specifically expressed in the suprachiasmatic nuclei (SCN) of the hypothalamus. It has been shown that NMS is implicated in the regulation of circadian rhythms through autocrine and/or paracrine actions.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 1138204-27-9
Sequence ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH₂
Synonyms NMS (human)
Molecular Formula  C₁₇₃H₂₆₅N₅₃O₄₄
Storage -20℃, protected from light and moisture
Transportation 4-25℃ temperature for up to 3 weeks
Stability 1 year
Document

Related Product